PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_06313-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 851aa    MW: 94141 Da    PI: 4.9576
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_06313-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.94.2e-07701743145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +WT+ + +l++++ +q+G++ ++ I + ++  +++ q++ ++ 
  TRIUR3_06313-P1 701 RAKWTKSDTDLFYQGLQQFGSD-FAMIQQLFP-DKSRDQVRQKFK 743
                      569*******************.*********.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-9693748IPR009057Homeodomain-like
PfamPF159636.6E-24694774No hitNo description
Gene3DG3DSA:1.10.10.605.7E-4699744IPR009057Homeodomain-like
PROSITE profilePS5129310.322699750IPR017884SANT domain
SMARTSM007172.0E-7700748IPR001005SANT/Myb domain
CDDcd001672.09E-5703743No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MAYGGHVERE IPKPATHRSK QLPGGHKGGL DMIDDEANFG DITDAPAEAE AAAKFHPNKL  60
RGKLRKKSVP SRSVVPNRTV ETSDEKALAL SQDNLSQGLA TNQEIASSAV HGSETIGGAE  120
VCGGTIYTPS DDVLAVSSVD RVSQNDDPHD DPSEVATLQE SLVVSDTQAS STHPTSKTVD  180
DLADFGELFD THSEEENAAK SKLKIKVKLS KAASKYRKTG QKKAASTVDV VSQNKEDGND  240
DVRGCNDEQV QAQHEEHVQT SDSQPPLGTD DGTVDNFVNH NRILEEPGPE ETAAKLCPKS  300
QRKPGGASSK AVGTSDDYAA ANLKDINASV DIDSQDGLIN PHTDDTQPIF GEPSAEAAAT  360
FLLDLGKKKS KGKSVTFVLP DDYEGVAATD TNHNDIGSDE NLNTLPQQAP QKHCLTEEHS  420
DDQEYTDRES QYYEGERSDH GVEQQSKLDV GKQELSMKLR SRTEIQKVGL SEHIVDDHLD  480
EDFVEPSAAE QNNDSSDENT AGGKQKAPRK SRKKDPNKEP LRGSKRTSTK STSEKSQPNQ  540
QKNKSEVSSR GRKRALKDTM TEQPEKKLTH RIRQKRAQEV QTLLQKPDHE IDRMKLSVTH  600
LRLLQEARER IQSKTPSGPS SSNQRYFTFS DRVFEVGVAA AVFIPASKFV FLNLMSCSSR  660
FGDTDDFDPF GDNYDNDRTE NQALESATKL NYHSYMDKKT RAKWTKSDTD LFYQGLQQFG  720
SDFAMIQQLF PDKSRDQVRQ KFKSEDKKHP MQVHDAILHR SRDNLYLKQV MKQLNIEDSL  780
KDINITQKQE VASTEGNTGN DVISETNTFS VENVSNLSDE EMGTHQSEVK EGEDVAAGNA  840
DDVDLDVFDW Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3713370.0AK371337.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2131E22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227475.10.0PREDICTED: uncharacterized protein LOC104581510 isoform X3
TrEMBLM7ZGR30.0M7ZGR3_TRIUA; Transcription factor TFIIIB component B
STRINGMLOC_15633.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-28MYB_related family protein